PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g000304m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB
Protein Properties Length: 1698aa    MW: 185093 Da    PI: 5.5911
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g000304mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.92.6e-09724765346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +WT eE e++vd  + +G++ +++Ia+ ++  +t  +c+++++k
  orange1.1g000304m 724 PWTSEEREIFVDKLATFGKD-FRKIASFLN-YKTTADCVEFYYK 765
                        8*****************99.*********.9**********98 PP

2Myb_DNA-binding35.91.8e-11940980345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         WT eE  ++++av+ +G++ ++ Iar++  +R++ qck ++ 
  orange1.1g000304m 940 DWTDEEKSIFIQAVTSYGKD-FSMIARCIR-TRSRDQCKVFFS 980
                        6*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-13708768IPR009057Homeodomain-like
PROSITE profilePS5129315.167720771IPR017884SANT domain
SMARTSM007172.4E-9721769IPR001005SANT/Myb domain
PfamPF002491.1E-6723765IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-5724770IPR009057Homeodomain-like
PROSITE profilePS5129311.59936987IPR017884SANT domain
SMARTSM007171.6E-8937985IPR001005SANT/Myb domain
SuperFamilySSF466894.99E-11938987IPR009057Homeodomain-like
PfamPF002496.7E-8940980IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-7940981IPR009057Homeodomain-like
CDDcd001671.40E-7941979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1698 aa     Download sequence    Send to blast
MPEDESTRIS VSRGDGKYGR NSRENRSSFC QSDCKGYAWD TSNGYATTPG RLHEVNCNQR  60
SVDDMLTYPS HPQSDFVTWD HLQLKDQHDN KIGSVNGLAT GQRCESENSL DWKKIKWTRS  120
GSLSSRGSGL SHSSSSKSMG GVDSSEGKTD FQVKNATSIQ SPSGDAATYA TSGVLFEETT  180
SRKKPRLGWG EGLAKYEKKK VEVPDVSGNK DGVFNFSSNA EPLQSLSSNL AEKSPRVMGF  240
SDCASPATPS SVACSSSPGV EEKAFGKAVS VDNDVSNLCG SPSIVSQNHR EGFLFNLEKL  300
DTNSIGNLGS SLVELLQYDD PSSVDSSFVR STAMNKLLVW KGDILKTLEM TETEIDSLEN  360
ELKSLKSVLG STSPCPVTSI SLSVEDNANP FNKQGTVSNS IIRPAPLQID CGDLSVENMP  420
DCSHGLEEVH GNSKDEDIDS PGTATSKFVE PSSFVKPVSP SNMLKNGESF GVLDTVHSSN  480
TEVKCTMPGS SFGEVVAGAS TCGDGDMILE SKNDALISSN FSAYADGENM LCDMILGANK  540
ELANEASEVL KKLLPRDHSN IDISGVANVF CCQNDSLVKE KFAKKKQLLR FKERVLTLKF  600
KAFQHLWRED LRLLSIRKYR ARSQKKCELS LRTTYTGYQK HRSSIRSRFS SPAAGNLSLV  660
QTAEVINFTS KLLSDSQIKT YRNSLKMPAL ILDKKEKMSS RFISSNGLVE DPCAVEKERA  720
MINPWTSEER EIFVDKLATF GKDFRKIASF LNYKTTADCV EFYYKNHKSD CFEKLKKKHD  780
FSKQGKTSTN TYLVTTGKRN RKMNAASLDI LGEASEIAAA AQVDGRQLIS SGRISSGGRG  840
DSRTSLGDDG IIERSSSFDV IGGERETAAA DVLAGICGSL SSEAMSSCIT SSVDPAEGQR  900
DWRRQKADSV MRLPSTSDVT QNVDDDTCSD ESCGEMDPSD WTDEEKSIFI QAVTSYGKDF  960
SMIARCIRTR SRDQCKVFFS KARKCLGLDL IHTGRGNVGP SVNDDANGGG SDTEDACVLE  1020
TSSVNCSDKL GSKTDEELPS HVIHSNQEES CSAGAKNLQT DLNKPEDDNG ITPLNDKDSE  1080
AVKPVNNDAF RTESRSFELE SNNMNGMDNQ SESVLDQKNA VELFKTAVRD KVAEQGAVSV  1140
SAGEESDPCP SSSNAVEETN DVVAEASTEG FGNGLERYQP MLLENSLNDV RDKICNVDAC  1200
GESEIVQDSN TTGSAFDLYV DASSHSVSSK LDSVDKPPLI SLPQWNSHPA AASTQDSSVI  1260
QCEKAFIQDR MSSTLEFQRS KDKSGHKSVV SDDYRQHLSV HSIVNHVESP QILNGYPLPI  1320
STKKEMNGDI NCRQLSEVQS ISKSDRNIDE PYLAQDCYLR KCNSSMPHSS VTELPFLAEN  1380
IEQTSDRRRA HSCSFSDTEK PSKNGDVKLF GKILSHPSSS QKSAFSSHDN GENGHHHKQS  1440
SKASNLKFTA HHPPDGGAAL LKFDRNNYVG LENGPARSYG FWDGSKIQTG FSSLPDSAIL  1500
LAKYPAAFGG YPASSSKMEQ QSLQAAVVKS NERHLNGVAV VPPREISSSN GVVDYQVYRS  1560
REGNKVQPFS VDMKQRQEFL FAEMQXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  1620
RNGFEALSSI QQQGKGMVGV NVVGRGGILV GGGSCTGVSD PVAAIRMHYA KAEQYGGQGG  1680
SIIREEESWR GKGDIGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C6e-14687773994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D6e-14687773994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.108111e-126flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436269.10.0hypothetical protein CICLE_v10030482mg
RefseqXP_006436270.10.0hypothetical protein CICLE_v10030482mg
RefseqXP_006485882.10.0PREDICTED: uncharacterized protein LOC102608361 isoform X1
RefseqXP_006485883.10.0PREDICTED: uncharacterized protein LOC102608361 isoform X1
TrEMBLA0A067DZP50.0A0A067DZP5_CITSI; Uncharacterized protein (Fragment)
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein